McDonnell Genome Institute

Washington University

Transcript

lnc-RHOBTB1-2:1

Chromosome

chr10

Gene Name

lnc-RHOBTB1-2

Start

60507500

CPC Label

noncoding

End

60733324

Cancer

CCRC

Strand

-

Peptide

ASSASSSPAGTEDSAPAQGGFGSDYSR

Modified Peptide

n[43]ASSASSSPAGTEDSAPAQGGFGSDYSR

Peptide Length

27

ORF Length

57

Open Reading Frame (ORF)

MASSASSSPAGTEDSAPAQGGFGSDYSRSSRKVSELGIGHCLLCFLSGSYSCCHFVD

Conservation Score

1

PhyloCSF Frame 1

2.941

No. of Spectra

30

CPC Coding Probability

0.0481165

PhyloCSF Frame 2 

-4.274

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-2.216

CNTI Score

-0.462504819