McDonnell Genome Institute

Washington University

Transcript

lnc-RHOB-3:5

Chromosome

chr2

Gene Name

lnc-RHOB-3

Start

19990210

CPC Label

noncoding

End

19991626

Cancer

OV

Strand

+

Peptide

HWPDESANVR

Modified Peptide

n[145]HWPDESANVR

Peptide Length

10

ORF Length

55

Open Reading Frame (ORF)

LKGKSHLLYLIGWRHWPDESANVRTEILQPFSVSLGIGEPLEQFRNRRFCLFRLF

Conservation Score

0.084

PhyloCSF Frame 1

-5.173

No. of Spectra

19

CPC Coding Probability

0.0799626

PhyloCSF Frame 2 

-5.394

CNTI Index

coding

Max Probability

0.9673

PhyloCSF Frame 3

-3.357

CNTI Score

0.619111671