McDonnell Genome Institute

Washington University

Transcript

lnc-RHOB-2:11

Chromosome

chr2

Gene Name

lnc-RHOB-2

Start

20052136

CPC Label

noncoding

End

20096363

Cancer

CRC

Strand

+

Peptide

LALSFCPSHHMIDWK

Modified Peptide

LALSFCPSHHMIDWK

Peptide Length

15

ORF Length

76

Open Reading Frame (ORF)

MKHIEMDKKLLNVFNEKTAIVWHTVPGILLLEGLSAFLCGALHNSFPLERHQGRHLGKLALSFCPSHHMIDWKNGK

Conservation Score

0.559

PhyloCSF Frame 1

-3.541

No. of Spectra

1

CPC Coding Probability

0.0434866

PhyloCSF Frame 2 

-4.168

CNTI Index

noncoding

Max Probability

0.6114

PhyloCSF Frame 3

-4.908

CNTI Score

-0.335245562