McDonnell Genome Institute

Washington University

Transcript

lnc-RHEX-6:1

Chromosome

chr1

Gene Name

lnc-RHEX-6

Start

205898728

CPC Label

coding

End

205905786

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

SNWYQSLQK

Modified Peptide

n[145]SNWYQSLQK

Peptide Length

9

ORF Length

37

Open Reading Frame (ORF)

MLRAFVTTRPALQELLKEALNMERSNWYQSLQKHAKL

Conservation Score

0.779

PhyloCSF Frame 1

0

No. of Spectra

23

CPC Coding Probability

0.998365

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9182

PhyloCSF Frame 3

0

CNTI Score

-0.311252143