McDonnell Genome Institute

Washington University

Transcript

lnc-RHEX-1:1

Chromosome

chr1

Gene Name

lnc-RHEX-1

Start

206035236

CPC Label

noncoding

End

206044983

Cancer

PRAD

Strand

+

Peptide

APPAAAAAPGDSITEHQLGAETGQCTR

Modified Peptide

APPAAAAAPGDSITEHQLGAETGQCTR

Peptide Length

27

ORF Length

43

Open Reading Frame (ORF)

MAPPAAAAAPGDSITEHQLGAETGQCTRVQRQETRIFPEGVTV

Conservation Score

0.997

PhyloCSF Frame 1

-3.982

No. of Spectra

10

CPC Coding Probability

0.0370305

PhyloCSF Frame 2 

-0.553

CNTI Index

noncoding

Max Probability

0.8136

PhyloCSF Frame 3

-5.538

CNTI Score

-0.416863282