McDonnell Genome Institute

Washington University

Transcript

lnc-RHD-1:1

Chromosome

chr1

Gene Name

lnc-RHD-1

Start

25208138

CPC Label

noncoding

End

25208869

Cancer

OV

Strand

+

Peptide

LNSELLHFYLK

Modified Peptide

n[145]LNSELLHFYLK

Peptide Length

11

ORF Length

44

Open Reading Frame (ORF)

LNSELLHFYLKLKLKFCFLCSSGSTPATLASLLLLKTHQPHSCI

Conservation Score

0.08

PhyloCSF Frame 1

-4.081

No. of Spectra

3

CPC Coding Probability

0.0000125

PhyloCSF Frame 2 

-4.745

CNTI Index

noncoding

Max Probability

0.9385

PhyloCSF Frame 3

-5.136

CNTI Score

-0.44293083