McDonnell Genome Institute

Washington University

Transcript

lnc-RHBDD3-3:5

Chromosome

chr22

Gene Name

lnc-RHBDD3-3

Start

29180622

CPC Label

noncoding

End

29205832

Cancer

HCC

Strand

-

Peptide

KEPGGAR

Modified Peptide

n[230]KEPGGAR

Peptide Length

7

ORF Length

50

Open Reading Frame (ORF)

LPTRKEPGGARAARAPPPGGPPGVHLSPTPCAAGPFWGRGASSEVSSHGL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.0658221

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.326789054