McDonnell Genome Institute

Washington University

Transcript

lnc-RHBDD3-3:3

Chromosome

chr22

Gene Name

lnc-RHBDD3-3

Start

29184626

CPC Label

noncoding

End

29205832

Cancer

PRAD

Strand

-

Peptide

GEQLPGLNMQQDTR

Modified Peptide

‚Äč

Peptide Length

14

ORF Length

103

Open Reading Frame (ORF)

LEVGQTCATHWLEQGPHLSQPQSLHLYAGANNDGGCLIEQVMIQWRNVQHTAGTRHIVSKWPCFHQKGEQLPGLNMQQDTRNVFFGCISSLSSHWPLLEVAHR

Conservation Score

1

PhyloCSF Frame 1

-2.972

No. of Spectra

15

CPC Coding Probability

0.0444346

PhyloCSF Frame 2 

-2.673

CNTI Index

noncoding

Max Probability

0.9625

PhyloCSF Frame 3

-3.413

CNTI Score

-0.338002397