McDonnell Genome Institute

Washington University

Transcript

lnc-RHBDD1-6:6

Chromosome

chr2

Gene Name

lnc-RHBDD1-6

Start

226800145

CPC Label

noncoding

End

226815940

Cancer

LUAD

Strand

+

Peptide

LMHLQFSYSGNLK

Modified Peptide

n[230]LMHLQFSYSGNLK

Peptide Length

13

ORF Length

44

Open Reading Frame (ORF)

LMHLQFSYSGNLKTGKRQIKNTECDSVTILKNRHLSSLPNIISL

Conservation Score

0.503

PhyloCSF Frame 1

-5.462

No. of Spectra

5

CPC Coding Probability

0.0932693

PhyloCSF Frame 2 

-5.268

CNTI Index

noncoding

Max Probability

0.9958

PhyloCSF Frame 3

-3.541

CNTI Score

-0.328418604