McDonnell Genome Institute

Washington University

Transcript

lnc-RHBDD1-6:2

Chromosome

chr2

Gene Name

lnc-RHBDD1-6

Start

226799927

CPC Label

noncoding

End

226815940

Cancer

OSCC

Strand

+

Peptide

VQHTQMCTVGQLR

Modified Peptide

n[145]VQHTQMCTVGQLR

Peptide Length

13

ORF Length

92

Open Reading Frame (ORF)

MYKILTLIADAHNVYDLTEFFSGITKVQHTQMCTVGQLRMAEDSSHLCHMVTCPTPPGDLARACGYLLRLRMFPTKLLTLFHSVRGCLWFIC

Conservation Score

0.27

PhyloCSF Frame 1

-5.197

No. of Spectra

62

CPC Coding Probability

0.0766176

PhyloCSF Frame 2 

-5.142

CNTI Index

noncoding

Max Probability

0.971

PhyloCSF Frame 3

-4.188

CNTI Score

-0.325924221