McDonnell Genome Institute

Washington University

Transcript

lnc-RHBDD1-6:1

Chromosome

chr2

Gene Name

lnc-RHBDD1-6

Start

226799927

CPC Label

noncoding

End

226815940

Cancer

OV

Strand

+

Peptide

LGVQGYR

Modified Peptide

n[145]LGVQGYR

Peptide Length

7

ORF Length

34

Open Reading Frame (ORF)

LLMQIDSIEKGNSRLGVQGYRQGDRNIAWDFLGQ

Conservation Score

0.364

PhyloCSF Frame 1

-4.921

No. of Spectra

1

CPC Coding Probability

0.13875

PhyloCSF Frame 2 

-6.701

CNTI Index

noncoding

Max Probability

0.8167

PhyloCSF Frame 3

-6.156

CNTI Score

-0.325924221