McDonnell Genome Institute

Washington University

Transcript

lnc-RGSL1-6:1

Chromosome

chr1

Gene Name

lnc-RGSL1-6

Start

182271984

CPC Label

noncoding

End

182280947

Cancer

HCC

Strand

+

Peptide

QICHDLLMDWIK

Modified Peptide

QICHDLLMDWIK

Peptide Length

12

ORF Length

82

Open Reading Frame (ORF)

LKSASDLDYSCEGSLYAHWGEQTGRRQEERSVRRPEISGGGQSGSGFDVAGMVMMGLLDEFRKQICHDLLMDWIKGISEGEE

Conservation Score

0.856

PhyloCSF Frame 1

-5.217

No. of Spectra

5

CPC Coding Probability

0.0318053

PhyloCSF Frame 2 

-4.18

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-5.616

CNTI Score

-0.350053913