McDonnell Genome Institute

Washington University

Transcript

lnc-RGS9-15:3

Chromosome

chr17

Gene Name

lnc-RGS9-15

Start

64930148

CPC Label

noncoding

End

64934203

Cancer

PRAD

Strand

+

Peptide

KKNMLEEK

Modified Peptide

KKNM[147]LEEK

Peptide Length

8

ORF Length

53

Open Reading Frame (ORF)

LTFVKKKNMLEEKWKRTLHALSSDAISSGSSSGPCQGWIRCPQGTHDADPGPS

Conservation Score

0.851

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.120497

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6768

PhyloCSF Frame 3

0

CNTI Score

-0.437764969