McDonnell Genome Institute

Washington University

Transcript

lnc-RGS6-3:1

Chromosome

chr14

Gene Name

lnc-RGS6-3

Start

71740337

CPC Label

noncoding

End

71741209

Cancer

PRAD

Strand

+

Peptide

GTFSTLAASDWK

Modified Peptide

‚Äč

Peptide Length

12

ORF Length

75

Open Reading Frame (ORF)

LFVAFITVTKPTPLPFQWQLWSKGTFSTLAASDWKFPHPSNLNSFLSPSLKETGWIFLSSPCYIHYQIFMLQFHS

Conservation Score

1

PhyloCSF Frame 1

-4.072

No. of Spectra

6

CPC Coding Probability

0.0167745

PhyloCSF Frame 2 

-2.746

CNTI Index

noncoding

Max Probability

0.707

PhyloCSF Frame 3

-2.809

CNTI Score

-0.453561442