McDonnell Genome Institute

Washington University

Transcript

lnc-RGS5-2:2

Chromosome

chr1

Gene Name

lnc-RGS5-2

Start

163421069

CPC Label

noncoding

End

163423180

Cancer

HCC

Strand

-

Peptide

MGLVSLQEEK

Modified Peptide

n[230]MGLVSLQEEK

Peptide Length

10

ORF Length

42

Open Reading Frame (ORF)

MMGLVSLQEEKETRALSFSPQSKDTERKWPSTSQEKGALTRH

Conservation Score

0.007

PhyloCSF Frame 1

-3.148

No. of Spectra

42

CPC Coding Probability

0.0119491

PhyloCSF Frame 2 

-5.105

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-5.213

CNTI Score

-0.376334206