McDonnell Genome Institute

Washington University

Transcript

lnc-RGS3-4:6

Chromosome

chr9

Gene Name

lnc-RGS3-4

Start

113650955

CPC Label

noncoding

End

113682855

Cancer

HCC

Strand

+

Peptide

LMGGEVAVK

Modified Peptide

n[230]LMGGEVAVK

Peptide Length

9

ORF Length

41

Open Reading Frame (ORF)

LMGGEVAVKALEMKTLDTGPLESLECRFLLGGLGFQQSPSS

Conservation Score

0.03

PhyloCSF Frame 1

-5.71

No. of Spectra

3

CPC Coding Probability

0.158195

PhyloCSF Frame 2 

-4.461

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

-4.38

CNTI Score

-0.38997135