McDonnell Genome Institute

Washington University

Transcript

lnc-RGS3-4:2

Chromosome

chr9

Gene Name

lnc-RGS3-4

Start

113615348

CPC Label

noncoding

End

113629015

Cancer

PRAD

Strand

+

Peptide

FAIEIQSWK

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

51

Open Reading Frame (ORF)

LGQSDFPVRKFAIEIQSWKESPALMGAAFVDCDSEAEAPGSRPHGPWASPE

Conservation Score

0.865

PhyloCSF Frame 1

-4.799

No. of Spectra

2

CPC Coding Probability

0.0684869

PhyloCSF Frame 2 

-5.524

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

-4.668

CNTI Score

-0.292938563