McDonnell Genome Institute

Washington University

Transcript

lnc-RGS3-1:1

Chromosome

chr9

Gene Name

lnc-RGS3-1

Start

113619227

CPC Label

noncoding

End

113622634

Cancer

OV

Strand

+

Peptide

LLVHDALQMLDQER

Modified Peptide

n[145]LLVHDALQMLDQER

Peptide Length

14

ORF Length

81

Open Reading Frame (ORF)

LLVHDALQMLDQERNWVGGQDTGPALWEESCSQAVWWHQSLCVVSQAGQPISSPFSPNSGLLYLEGLPLCSCSPEALRGLT

Conservation Score

0.229

PhyloCSF Frame 1

-4.056

No. of Spectra

3

CPC Coding Probability

0.0465814

PhyloCSF Frame 2 

-5.237

CNTI Index

noncoding

Max Probability

0.8903

PhyloCSF Frame 3

-4.111

CNTI Score

-0.326751081