McDonnell Genome Institute

Washington University

Transcript

lnc-RGS20-4:1

Chromosome

chr8

Gene Name

lnc-RGS20-4

Start

53532907

CPC Label

noncoding

End

53533704

Cancer

BRCA-Luminal B

Strand

+

Peptide

LAMFMQICK

Modified Peptide

n[145]LAM[147]FMQICK

Peptide Length

9

ORF Length

133

Open Reading Frame (ORF)

LAMFMQICKRGGIIDIKGRGTVQKGMPHKCYHGKTKSLQCCPACCWHCCNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRLKEHDQKKKEAKEKGTWVQLKRHPAPPRDTHCVRTSGKEPELRKLFPMDSWH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.16749

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7889

PhyloCSF Frame 3

0

CNTI Score

-0.335485353