McDonnell Genome Institute

Washington University

Transcript

lnc-RGS20-3:1

Chromosome

chr8

Gene Name

lnc-RGS20-3

Start

53537059

CPC Label

noncoding

End

53540300

Cancer

EOGC

Strand

+

Peptide

KEDPEMLETEPVEDGK

Modified Peptide

n[145]KEDPEM[147]LETEPVEDGK

Peptide Length

16

ORF Length

93

Open Reading Frame (ORF)

LDKFFSRKEDPEMLETEPVEDGKLGERGNEEGFLNNSGEFLSNKQLESIGIPQFHSPVGSPLKSTQATGTPSAVKSSPQIPHQTYSSILKHLS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.105302

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3058

PhyloCSF Frame 3

0

CNTI Score

-0.333012801