McDonnell Genome Institute

Washington University

Transcript

lnc-RGPD2-1:1

Chromosome

chr2

Gene Name

lnc-RGPD2-1

Start

87565827

CPC Label

coding

End

87566764

Cancer

BRCA-Luminal B

Strand

-

Peptide

VIFHPVFSVMVSASEDATVK

Modified Peptide

n[145]VIFHPVFSVM[147]VSASEDATVK

Peptide Length

20

ORF Length

47

Open Reading Frame (ORF)

LSGHRSPIIRVIFHPVFSVMVSASEDATVKVWDYETGDFERTLKGRT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.589606

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.709

PhyloCSF Frame 3

0

CNTI Score

-0.37031581