McDonnell Genome Institute

Washington University

Transcript

lnc-RGMA-28:2

Chromosome

chr15

Gene Name

lnc-RGMA-28

Start

95015762

CPC Label

noncoding

End

95018126

Cancer

BRCA-Luminal A

Strand

-

Peptide

SGLCLFCVYK

Modified Peptide

n[145]SGLCLFCVYK

Peptide Length

10

ORF Length

44

Open Reading Frame (ORF)

LFLKMYKIASSLKGFCCIISLRNKAFGCSCYALKSGLCLFCVYK

Conservation Score

0.068

PhyloCSF Frame 1

-5.288

No. of Spectra

2

CPC Coding Probability

0.16005

PhyloCSF Frame 2 

-5.63

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

-5.545

CNTI Score

-0.340934403