McDonnell Genome Institute

Washington University

Transcript

lnc-RGMA-19:3

Chromosome

chr15

Gene Name

lnc-RGMA-19

Start

95847294

CPC Label

noncoding

End

95872193

Cancer

HCC

Strand

-

Peptide

VHLTQPCK

Modified Peptide

n[230]VHLTQPCK

Peptide Length

8

ORF Length

61

Open Reading Frame (ORF)

LVYTTKNKKLFLYFRVHLTQPCKINSHLIFTQSPRTLSLEPVTYCSWHCVLHIWGPHLITA

Conservation Score

0.397

PhyloCSF Frame 1

-5.306

No. of Spectra

1

CPC Coding Probability

0.0462226

PhyloCSF Frame 2 

-4.661

CNTI Index

coding

Max Probability

0.9999

PhyloCSF Frame 3

-6.201

CNTI Score

0.605553836