McDonnell Genome Institute

Washington University

Transcript

lnc-RGMA-19:1

Chromosome

chr15

Gene Name

lnc-RGMA-19

Start

95793444

CPC Label

noncoding

End

95872193

Cancer

OSCC

Strand

-

Peptide

MLFVSIEPGK

Modified Peptide

n[145]M[147]LFVSIEPGK

Peptide Length

10

ORF Length

59

Open Reading Frame (ORF)

MLFVSIEPGKIAQIIKLFQQELKNIMWFCFHLSSKIDSTVSILQIRFSGTRKMLVYKRH

Conservation Score

0.313

PhyloCSF Frame 1

-6.121

No. of Spectra

73

CPC Coding Probability

0.0358687

PhyloCSF Frame 2 

-5.454

CNTI Index

noncoding

Max Probability

0.9928

PhyloCSF Frame 3

-5.742

CNTI Score

-0.344576774