McDonnell Genome Institute

Washington University

Transcript

lnc-RGMA-12:1

Chromosome

chr15

Gene Name

lnc-RGMA-12

Start

93430658

CPC Label

noncoding

End

93431217

Cancer

EOGC

Strand

-

Peptide

HGGLSLVQTTDYVYRIVDDPSMMGR

Modified Peptide

n[145]HGGLSLVQTTDYVYRIVDDPSM[147]M[147]GR

Peptide Length

25

ORF Length

130

Open Reading Frame (ORF)

LGAVTPRLGIGMDTRVIPLRHGGLSLVQTTDYVYRIVDDPSMMGRIARASVFSDLYAMWVTECDNMLMLLGVSPKMTDRERDKMMSLIIQGFKDAAEEAGTSVMGGQTILNPWIALGGVATTVCQPNEFI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

82

CPC Coding Probability

0.0989845

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.322226456