McDonnell Genome Institute

Washington University

Transcript

lnc-RGMA-10:2

Chromosome

chr15

Gene Name

lnc-RGMA-10

Start

95034383

CPC Label

noncoding

End

95035737

Cancer

OV

Strand

-

Peptide

ILCVILFEK

Modified Peptide

n[145]ILCVILFEK

Peptide Length

9

ORF Length

55

Open Reading Frame (ORF)

MFQNGKILCVILFEKKNQEAPLHACEPSRCAYKHACVYMKHNQHLEYPPSGKART

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.410589

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9747

PhyloCSF Frame 3

-5.222

CNTI Score

-0.326781761