McDonnell Genome Institute

Washington University

Transcript

lnc-RFXAP-2:1

Chromosome

chr13

Gene Name

lnc-RFXAP-2

Start

36843532

CPC Label

noncoding

End

36845846

Cancer

CCRC

Strand

+

Peptide

VLHISFLK

Modified Peptide

n[230]VLHISFLK

Peptide Length

8

ORF Length

35

Open Reading Frame (ORF)

MFTIMKVLILSYILQYHVFATIQKKVLHISFLKLL

Conservation Score

0.269

PhyloCSF Frame 1

-4.392

No. of Spectra

22

CPC Coding Probability

0.0516914

PhyloCSF Frame 2 

-4.638

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

-3.089

CNTI Score

-0.392777175