McDonnell Genome Institute

Washington University

Transcript

lnc-RFX2-1:11

Chromosome

chr19

Gene Name

lnc-RFX2-1

Start

6176274

CPC Label

noncoding

End

6199524

Cancer

OV

Strand

-

Peptide

LLVVLDITWMAGAVAK

Modified Peptide

n[145]LLVVLDITWMAGAVAK

Peptide Length

16

ORF Length

62

Open Reading Frame (ORF)

LLVVLDITWMAGAVAKDFQLTDKHEMVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALK

Conservation Score

1

PhyloCSF Frame 1

-2.565

No. of Spectra

2

CPC Coding Probability

0.0227469

PhyloCSF Frame 2 

-1.94

CNTI Index

noncoding

Max Probability

0.8353

PhyloCSF Frame 3

3.511

CNTI Score

-0.340158839