McDonnell Genome Institute

Washington University

Transcript

lnc-RFC2-3:1

Chromosome

chr7

Gene Name

lnc-RFC2-3

Start

74256549

CPC Label

noncoding

End

74256770

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

FEGFAGR

Modified Peptide

n[145]FEGFAGR

Peptide Length

7

ORF Length

48

Open Reading Frame (ORF)

LRFEGFAGRNSPWLLYALSQEPVVSPALPGSPTLLFFSPRGAAGVFKF

Conservation Score

0.87

PhyloCSF Frame 1

-5.518

No. of Spectra

25

CPC Coding Probability

0.140715

PhyloCSF Frame 2 

-3.39

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

-4.966

CNTI Score

-0.465407365