McDonnell Genome Institute

Washington University

Transcript

lnc-RETREG2-1:1

Chromosome

chr2

Gene Name

lnc-RETREG2-1

Start

219186716

CPC Label

noncoding

End

219188117

Cancer

OV

Strand

+

Peptide

LFSFMNYPVSGILLR

Modified Peptide

n[145]LFSFM[147]NYPVSGILLR

Peptide Length

15

ORF Length

59

Open Reading Frame (ORF)

LCYLKTLQSPYQQEDPHQMRLLNLRLLIPHHCKKLFSFMNYPVSGILLRYKQRKMDEDR

Conservation Score

0.072

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0217965

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7733

PhyloCSF Frame 3

0

CNTI Score

-0.395861189