McDonnell Genome Institute

Washington University

Transcript

lnc-RETN-1:1

Chromosome

chr19

Gene Name

lnc-RETN-1

Start

7665716

CPC Label

noncoding

End

7666476

Cancer

EOGC

Strand

+

Peptide

TLSDYNIQKESPLHLVLR

Modified Peptide

n[145]TLSDYNIQKESPLHLVLR

Peptide Length

18

ORF Length

74

Open Reading Frame (ORF)

LKTLTGKTTTLEAEPSDMVENVKAKIQGKERIPPDQQRQALEDGRTLSDYNIQKESPLHLVLRIRGGAKERKKS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0592134

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7364

PhyloCSF Frame 3

0

CNTI Score

-0.337180247