McDonnell Genome Institute

Washington University

Transcript

lnc-REPS1-2:2

Chromosome

chr6

Gene Name

lnc-REPS1-2

Start

139024856

CPC Label

noncoding

End

139029043

Cancer

OV

Strand

-

Peptide

LSPQPAVPGGAPR

Modified Peptide

n[145]LSPQPAVPGGAPR

Peptide Length

13

ORF Length

62

Open Reading Frame (ORF)

LTRLSPQPAVPGGAPRTPSPSLLPKPHLPGRSRTSLRGFPSRRRTGAAWVWTRLPSSVHWGG

Conservation Score

1

PhyloCSF Frame 1

-1.489

No. of Spectra

6

CPC Coding Probability

0.04661

PhyloCSF Frame 2 

0.163

CNTI Index

noncoding

Max Probability

0.6748

PhyloCSF Frame 3

-2.034

CNTI Score

-0.348756673