McDonnell Genome Institute

Washington University

Transcript

lnc-RELL1-9:1

Chromosome

chr4

Gene Name

lnc-RELL1-9

Start

36065059

CPC Label

noncoding

End

36065726

Cancer

HCC

Strand

-

Peptide

KSLELTSR

Modified Peptide

n[230]KSLELTSR

Peptide Length

8

ORF Length

51

Open Reading Frame (ORF)

LMCVNCFSRSTCKSRLTLKIKFVEFDMKPVCKNFPLELKKRLKKSLELTSR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0990733

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7677

PhyloCSF Frame 3

0

CNTI Score

-0.304270016