McDonnell Genome Institute

Washington University

Transcript

lnc-RELL1-1:1

Chromosome

chr4

Gene Name

lnc-RELL1-1

Start

37588086

CPC Label

noncoding

End

37588875

Cancer

OV

Strand

-

Peptide

EGTSAFLICYLLQR

Modified Peptide

n[145]EGTSAFLICYLLQR

Peptide Length

14

ORF Length

51

Open Reading Frame (ORF)

MLDREGTSAFLICYLLQRTQEPHQGTAHCTQQQEGKEILTDSLPGHLLLKS

Conservation Score

0.007

PhyloCSF Frame 1

-4.685

No. of Spectra

1

CPC Coding Probability

0.0377392

PhyloCSF Frame 2 

-2.72

CNTI Index

noncoding

Max Probability

0.2373

PhyloCSF Frame 3

-4.182

CNTI Score

-0.379150077