McDonnell Genome Institute

Washington University

Transcript

lnc-REG3A-5:1

Chromosome

chr2

Gene Name

lnc-REG3A-5

Start

79492418

CPC Label

noncoding

End

79493364

Cancer

PRAD

Strand

-

Peptide

ISSMMLNNNGK

Modified Peptide

Peptide Length

11

ORF Length

83

Open Reading Frame (ORF)

LEAFSSFLFPFPSLPSPPLPSCFSFYLLSYFCLFVLVRISSMMLNNNGKSSYPCLVPHFRGLTLEFLSMPLVKFKKFFPIIVC

Conservation Score

0.061

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0338943

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8428

PhyloCSF Frame 3

0

CNTI Score

-0.579878453