McDonnell Genome Institute

Washington University

Transcript

lnc-REG1B-1:1

Chromosome

chr2

Gene Name

lnc-REG1B-1

Start

78919445

CPC Label

noncoding

End

78931380

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

GDKVQEALK

Modified Peptide

n[145]GDKVQEALK

Peptide Length

9

ORF Length

61

Open Reading Frame (ORF)

LIPKSSRQNDPIFFTCVIHLKSKGDKVQEALKKVAEIEGLHPIPPSDRITSVWNLVQVGTH

Conservation Score

0.071

PhyloCSF Frame 1

-4.355

No. of Spectra

12

CPC Coding Probability

0.0263588

PhyloCSF Frame 2 

-4.288

CNTI Index

noncoding

Max Probability

0.8389

PhyloCSF Frame 3

-4.654

CNTI Score

-0.397206639