McDonnell Genome Institute

Washington University

Transcript

lnc-REEP3-13:1

Chromosome

chr10

Gene Name

lnc-REEP3-13

Start

63713667

CPC Label

noncoding

End

63714405

Cancer

OV

Strand

+

Peptide

LFSCLSLPSNWYYR

Modified Peptide

n[145]LFSCLSLPSNWYYR

Peptide Length

14

ORF Length

53

Open Reading Frame (ORF)

MESHSFSQARVHWCDLGSLQPPPPGFKLFSCLSLPSNWYYRHAPPCLATFLHF

Conservation Score

0.015

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.156797

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.919

PhyloCSF Frame 3

0

CNTI Score

-0.489939709