McDonnell Genome Institute

Washington University

Transcript

lnc-REEP3-12:1

Chromosome

chr10

Gene Name

lnc-REEP3-12

Start

63630316

CPC Label

noncoding

End

63646548

Cancer

OV

Strand

+

Peptide

LFDAPILNK

Modified Peptide

n[145]LFDAPILNK

Peptide Length

9

ORF Length

146

Open Reading Frame (ORF)

LRRRPFLARSDSPRSSPAPSWVSGRVNPDDPTRRSWILCPLPPTKSLTGEGGATNVLQTFSKARAAGRSLLKAGAPLRRLFARRGFDVSLSNSVCQGIRAVSKSLRLFDAPILNKSFPFDLFNQGEGGLCCYLKVILHPSCPQIFI

Conservation Score

1

PhyloCSF Frame 1

-2.411

No. of Spectra

1

CPC Coding Probability

0.079202

PhyloCSF Frame 2 

1.297

CNTI Index

noncoding

Max Probability

0.9609

PhyloCSF Frame 3

-2.943

CNTI Score

-0.350395583