McDonnell Genome Institute

Washington University

Transcript

lnc-RECQL4-2:3

Chromosome

chr8

Gene Name

lnc-RECQL4-2

Start

144496379

CPC Label

coding

End

144500280

Cancer

OV

Strand

-

Peptide

LWTMAPSASSLCLQASR

Modified Peptide

n[145]LWTM[147]APSASSLCLQASR

Peptide Length

17

ORF Length

187

Open Reading Frame (ORF)

LWTMAPSASSLCLQASREGSCPHGKMQARHCRLLFTLCSGGRQEGVSRATTVPLPPRLQSTRSGTHTAGAASVGHRSFRAAASRRTTLGGKRTCFRSPWLAASFRGRSPGPFLPWASFSAWAHIFTCWARRFWACFSRSCVLILPTMGISASSSRCSAMAAAACPQGCSGHQSGELGGQAGPEGWGS

Conservation Score

1

PhyloCSF Frame 1

2.03

No. of Spectra

1

CPC Coding Probability

0.938655

PhyloCSF Frame 2 

15

CNTI Index

noncoding

Max Probability

0.8091

PhyloCSF Frame 3

-3.063

CNTI Score

-0.221769226