McDonnell Genome Institute

Washington University

Transcript

lnc-RDH8-4:1

Chromosome

chr19

Gene Name

lnc-RDH8-4

Start

9994002

CPC Label

noncoding

End

9994475

Cancer

PRAD

Strand

+

Peptide

IPGSSNPPTSASQVAGTTSAHHHTWLIFYLYFV

Modified Peptide

Peptide Length

33

ORF Length

93

Open Reading Frame (ORF)

LNASDPPTSASQTAGITGMSHHAKAKILFFLIYLCILELRSCSLAQAGVQWHDHGSMQLRIPGSSNPPTSASQVAGTTSAHHHTWLIFYLYFV

Conservation Score

0.332

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.118194

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9575

PhyloCSF Frame 3

0

CNTI Score

-0.404271457