McDonnell Genome Institute

Washington University

Transcript

lnc-RDH8-3:1

Chromosome

chr19

Gene Name

lnc-RDH8-3

Start

10040139

CPC Label

noncoding

End

10041229

Cancer

CRC

Strand

+

Peptide

HLPELCGSSMKPSK

Modified Peptide

HLPELCGSSMKPSK

Peptide Length

14

ORF Length

71

Open Reading Frame (ORF)

MGYIRHLPELCGSSMKPSKFPRATSAPPNFAQPSLKQHEVCGCFRDSGIVLHPPRIYLTSQWTDMLWSSLG

Conservation Score

1

PhyloCSF Frame 1

-3.7

No. of Spectra

1

CPC Coding Probability

0.0981223

PhyloCSF Frame 2 

-2.519

CNTI Index

noncoding

Max Probability

0.9055

PhyloCSF Frame 3

4.333

CNTI Score

-0.415875422