McDonnell Genome Institute

Washington University

Transcript

lnc-RDH13-2:13

Chromosome

chr19

Gene Name

lnc-RDH13-2

Start

55063040

CPC Label

noncoding

End

55064368

Cancer

OSCC

Strand

-

Peptide

LIGPVPR

Modified Peptide

n[145]LIGPVPR

Peptide Length

7

ORF Length

62

Open Reading Frame (ORF)

MLIGPVPRIPAPSARAPPLAAQFRTRAQPRLRLRSPVAASRALPRSYPGGWCAASSAPTPDA

Conservation Score

0.445

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0347288

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5676

PhyloCSF Frame 3

0

CNTI Score

-0.331828058