McDonnell Genome Institute

Washington University

Transcript

lnc-RDH13-1:8

Chromosome

chr19

Gene Name

lnc-RDH13-1

Start

55039110

CPC Label

noncoding

End

55041889

Cancer

EOGC

Strand

-

Peptide

STALAGR

Modified Peptide

n[145]STALAGR

Peptide Length

7

ORF Length

65

Open Reading Frame (ORF)

MRDVGKMMAGRFLDINTLIVLILTTCKCTYKSTALAGRGGSCLYSQHFGRPNHKVRRSRPSWLTR

Conservation Score

0.052

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0405968

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

0

CNTI Score

-0.339491875