McDonnell Genome Institute

Washington University

Transcript

lnc-RDH10-4:1

Chromosome

chr8

Gene Name

lnc-RDH10-4

Start

73545665

CPC Label

noncoding

End

73547670

Cancer

OSCC

Strand

+

Peptide

HAPVMSEQFFEYAKIFYMQHSTYCSFLR

Modified Peptide

n[145]HAPVMSEQFFEYAKIFYMQHSTYCSFLR

Peptide Length

28

ORF Length

54

Open Reading Frame (ORF)

MHAPVMSEQFFEYAKIFYMQHSTYCSFLRVALGEKRTIHMKFQPLSFVGKKKSP

Conservation Score

0.647

PhyloCSF Frame 1

-4.746

No. of Spectra

4

CPC Coding Probability

0.0266667

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9245

PhyloCSF Frame 3

-4.113

CNTI Score

-0.396107183