McDonnell Genome Institute

Washington University

Transcript

lnc-RD3-11:1

Chromosome

chr1

Gene Name

lnc-RD3-11

Start

210678314

CPC Label

noncoding

End

210681932

Cancer

EOGC

Strand

-

Peptide

ADLSWFAGLAQMALGR

Modified Peptide

n[145]ADLSWFAGLAQMALGR

Peptide Length

16

ORF Length

110

Open Reading Frame (ORF)

LEGMELGVQVTAWTYPGSLPLPVLDGDPIPGTSALPKIFSVSESLRSETAHHPTPPHLLSPAQCSRRVPGLGPRLSVQGRADLSWFAGLAQMALGRQGLRAQGRVLLHEP

Conservation Score

0.456

PhyloCSF Frame 1

-4.401

No. of Spectra

3

CPC Coding Probability

0.146175

PhyloCSF Frame 2 

-3.724

CNTI Index

noncoding

Max Probability

0.1485

PhyloCSF Frame 3

-3.687

CNTI Score

-0.330085654