McDonnell Genome Institute

Washington University

Transcript

lnc-RCN1-5:2

Chromosome

chr11

Gene Name

lnc-RCN1-5

Start

31993576

CPC Label

noncoding

End

31999968

Cancer

OV

Strand

+

Peptide

DVGQWSVIGR

Modified Peptide

n[145]DVGQWSVIGR

Peptide Length

10

ORF Length

35

Open Reading Frame (ORF)

MPDCWELKDVGQWSVIGRSVELPWRDPGRGWAAPQ

Conservation Score

0.383

PhyloCSF Frame 1

-5.418

No. of Spectra

2

CPC Coding Probability

0.108419

PhyloCSF Frame 2 

-3.491

CNTI Index

noncoding

Max Probability

0.808

PhyloCSF Frame 3

-5.405

CNTI Score

-0.357640763