McDonnell Genome Institute

Washington University

Transcript

lnc-RCL1-4:2

Chromosome

chr9

Gene Name

lnc-RCL1-4

Start

4741372

CPC Label

noncoding

End

4752754

Cancer

OV

Strand

+

Peptide

LPTSGDPPALAFQSAGITDVSHR

Modified Peptide

n[145]LPTSGDPPALAFQSAGITDVSHR

Peptide Length

23

ORF Length

140

Open Reading Frame (ORF)

LKLPTSGDPPALAFQSAGITDVSHRARPRFVSLRRGLVLLPRLECCDAISAHCNLYFPGSGDSYTSASRVAGITGTRHHAQLIFIFFVEMGFHHVGQADLKLLTSNDLPALTSPSAGITGLSHPTVPSRAHTYSLLSKKE

Conservation Score

0.493

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.245944

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9847

PhyloCSF Frame 3

0

CNTI Score

0.611538924