McDonnell Genome Institute

Washington University

Transcript

lnc-RCHY1-7:1

Chromosome

chr4

Gene Name

lnc-RCHY1-7

Start

75174998

CPC Label

noncoding

End

75189386

Cancer

OSCC

Strand

-

Peptide

DFTEAGLK

Modified Peptide

n[145]DFTEAGLK

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

MSSQWQLKFNRSFKGNIQTIAPYKDFTEAGLKVCVSFEVR

Conservation Score

0.449

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.233653

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9938

PhyloCSF Frame 3

0

CNTI Score

-0.41434367