McDonnell Genome Institute

Washington University

Transcript

lnc-RCC1L-1:1

Chromosome

chr7

Gene Name

lnc-RCC1L-1

Start

75026204

CPC Label

noncoding

End

75031527

Cancer

PRAD

Strand

-

Peptide

AIPWPQRAPTHMLFSMTR

Modified Peptide

‚Äč

Peptide Length

18

ORF Length

94

Open Reading Frame (ORF)

LQSQPGRRAIPWPQRAPTHMLFSMTRGQSPGAAPGAQPEISKLAGYKKQKKQRSCLRKKCHPRRQDTGSVWPIQQAQVFRVRLLARAGERGHSG

Conservation Score

0.898

PhyloCSF Frame 1

-2.736

No. of Spectra

4

CPC Coding Probability

0.0753781

PhyloCSF Frame 2 

-1.565

CNTI Index

noncoding

Max Probability

0.7961

PhyloCSF Frame 3

-1.933

CNTI Score

-0.323097193