McDonnell Genome Institute

Washington University

Transcript

lnc-RCAN1-3:1

Chromosome

chr21

Gene Name

lnc-RCAN1-3

Start

34823463

CPC Label

noncoding

End

34826406

Cancer

BRCA-Luminal A

Strand

-

Peptide

ELSSLCPGSSAR

Modified Peptide

n[145]ELSSLCPGSSAR

Peptide Length

12

ORF Length

49

Open Reading Frame (ORF)

MRSDISLIFSRAPIPMESEVLTVIEKELSSLCPGSSARWGNRRPRCLLS

Conservation Score

0.241

PhyloCSF Frame 1

-5.966

No. of Spectra

6

CPC Coding Probability

0.102157

PhyloCSF Frame 2 

-3.767

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-4.924

CNTI Score

-0.340183114